PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010650-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 199aa    MW: 22865.9 Da    PI: 9.9574
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010650-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.91.4e-191663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT++Ed++l++ ++ +G ++Wk+Ia+t g++R++k+c++rw +yl
    NNU_010650-RA 16 RGAWTAQEDQKLAQIIEVHGAKRWKSIAATAGLNRSGKSCRLRWMNYL 63
                     89********************************************97 PP

2Myb_DNA-binding50.83.9e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
    NNU_010650-RA  69 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 114
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.3351163IPR017930Myb domain
SuperFamilySSF466896.6E-3014110IPR009057Homeodomain-like
SMARTSM007171.4E-141565IPR001005SANT/Myb domain
PfamPF002491.1E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-241770IPR009057Homeodomain-like
CDDcd001672.20E-101863No hitNo description
PROSITE profilePS5129425.67264118IPR017930Myb domain
SMARTSM007171.9E-1568116IPR001005SANT/Myb domain
PfamPF002491.6E-1469114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2571118IPR009057Homeodomain-like
CDDcd001673.85E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MALVMTDGTP KKELNRGAWT AQEDQKLAQI IEVHGAKRWK SIAATAGLNR SGKSCRLRWM  60
NYLRPNIKRG NISDQEEDLI LRLHKLLGNR WSLIAGRLPG RTDNEIKNYW NSHLSKKIIN  120
QQTEEKPSRV ARTTTTTCWS KRRKTCDSEK DQIQVTEDGT SKGHEGSVNN IDVDELLDFS  180
VEGPLMSLEW LRKFSEFKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-301311824128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261928.11e-146PREDICTED: transcription factor MYB114-like
SwissprotQ9FJA22e-51TT2_ARATH; Transcription factor TT2
TrEMBLA0A061GJK02e-81A0A061GJK0_THECC; Myb domain protein 23
TrEMBLM5WVH03e-81M5WVH0_PRUPE; Uncharacterized protein
STRINGVIT_09s0002g01380.t012e-77(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-52MYB family protein